General Information

  • ID:  hor005517
  • Uniprot ID:  Q92097
  • Protein name:  Progonadoliberin-3 (Progonadoliberin III)
  • Gene name:  gnrh3
  • Organism:  Oncorhynchus tshawytscha (Chinook salmon) (Salmo tshawytscha)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SVGELEATIKMMDTGGVVALPEETSAHVSERLRPYDVILKKWMPHK
  • Length:  46(29-74)
  • Propeptide:  VRVVVLALVAQVTLSQHWSYGWLPGGKRSVGELEATIKMMDTGGVVALPEETSAHVSERLRPYDVILKKWMPHK
  • Signal peptide:  VRVVVLALVAQVTLS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q92097-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005517_AF2.pdbhor005517_ESM.pdb

Physical Information

Mass: 595384 Formula: C228H371N61O68S3
Absent amino acids: CFNQ Common amino acids: EV
pI: 6.51 Basic residues: 8
Polar residues: 10 Hydrophobic residues: 15
Hydrophobicity: -25.87 Boman Index: -6355
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 88.91
Instability Index: 6158.7 Extinction Coefficient cystines: 6990
Absorbance 280nm: 155.33

Literature

  • PubMed ID:  1587389
  • Title:  The Atlantic salmon prepro-gonadotropin releasing hormone gene and mRNA.